PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC12G17240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 316aa    MW: 34209.8 Da    PI: 8.7016
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC12G17240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA96.62.8e-30150206158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      d+p+YVNaKQy +I++RR++R k+e+e++l  k+rkpylheSRh hA+rR+RgsgGrF
  OPUNC12G17240.1 150 DAPIYVNAKQYAAIIRRRHARSKAERENRL-VKARKPYLHESRHLHAMRRARGSGGRF 206
                      68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.1E-33148209IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.661149209IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.4E-22152174IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.5E-27152206IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.4E-22183206IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MMSFNKSHEG FGQVAAVASL ANNGGGSLPW LLYGEPLGQG KPAMSPEGVV PRAQTPLDPP  60
PVPAMDRGVP EILNFSMVPG KGEKGSEHST TIALQSPFAE YNGCFELGLG QSVVPSNYPY  120
ADQHYGLLSP CGVRSVPSGR ILIPPNMPAD APIYVNAKQY AAIIRRRHAR SKAERENRLV  180
KARKPYLHES RHLHAMRRAR GSGGRFLNTK KETNGKTTGG GRKVMDIIIP PLRPAASPSS  240
EIQHSEQCNP SSVSSLSGSE VSSIYEHEDV DHFHGFEHLR THFFTPLPSL MDLEHGAGNP  300
FKWTAASDGC CDLLKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-17150214266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
4g91_A6e-17150208261HAPB protein
4g92_A6e-17150208261HAPB protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880320.0AB288032.1 Oryza sativa Japonica Group OsHAP2F mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK0737420.0AK073742.1 Oryza sativa Japonica Group cDNA clone:J033067G24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618449.10.0PREDICTED: nuclear transcription factor Y subunit A-10
RefseqXP_015618450.10.0PREDICTED: nuclear transcription factor Y subunit A-10
TrEMBLA0A0E0MPP40.0A0A0E0MPP4_ORYPU; Uncharacterized protein
STRINGBGIOSGA035818-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os12g42400.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.34e-36nuclear factor Y, subunit A10